PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10022243m
Common NameEUTSA_v10022243mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 486aa    MW: 56843.7 Da    PI: 6.6698
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10022243mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.83.2e-25208261155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k r++W  eLH++F++ave L G+ kA+Pk+ile+m+v+g+t+e+v+SHLQk+R+
  Thhalv10022243m 208 KRRVVWDDELHKKFIKAVEYL-GTGKAVPKRILEMMNVNGITRENVASHLQKFRM 261
                      689******************.9*******************************8 PP

2Response_reg29.63.6e-11411421108
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl+ d +p  + +l+q l+  +y ev+ + + e a  ll++++  +D+ ++     ++d +++++e+     +lpii+++  ++ e +++ ++ 
  Thhalv10022243m  41 VLLFDQDPQYLLALEQHLKAFQY-EVTRCNEEERARYLLHHHRirFDIAIIE--AQNVDRFRFISEM-----DLPIIIISKDDSVESVIKWMNI 126
                      7999*******************.******************9888988876..5667777766654.....69******************** PP

                      TESEEEESS--HHHHH CS
     Response_reg  93 GakdflsKpfdpeelv 108
                      Ga d+l Kp+ pe+l+
  Thhalv10022243m 127 GACDYLIKPIRPEDLR 142
                      **************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521727.97E-1837161IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.0E-1638185No hitNo description
SMARTSM004483.3E-539145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011022.05740149IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.5E-741143IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.19E-942149No hitNo description
PROSITE profilePS5129412.099205264IPR017930Myb domain
SuperFamilySSF466891.7E-18205265IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-24206265IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-24208262IPR006447Myb domain, plants
PfamPF002496.7E-7210259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
GSRILAKKPD SIKKRRRYHP NSSDMFSGMY PENKFPEGLR VLLFDQDPQY LLALEQHLKA  60
FQYEVTRCNE EERARYLLHH HRIRFDIAII EAQNVDRFRF ISEMDLPIII ISKDDSVESV  120
IKWMNIGACD YLIKPIRPED LRLIFKHVAK KVQVRRNVVV AGEAEEKTET ENSSSVRDPT  180
VRNRNKRKKN IFLEGQENEE GHDPTTKKRR VVWDDELHKK FIKAVEYLGT GKAVPKRILE  240
MMNVNGITRE NVASHLQKFR MNQKKQNDQN EKNERNRVLI TPEAIDFYNR GNVQFTTQHI  300
NNIHQPFVQQ QSTNSNLMMQ FISPLEHHHH DGVSVAVSDR NMLMTHQAQH HHHHQNSEFS  360
NIENKEESLV YNEDDVTNLW WLIQNLDETS SFHYQDPVIV NDNQLSSNPQ QMMNVHEAHE  420
SSILHMPSSS SFFTHSSLLD QHVQQETITM VDVSGELNNN NGYSVNSNIQ NVNVGNIFLE  480
DSQDWD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-17207265462ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181186RNRNKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407384.10.0hypothetical protein EUTSA_v10022243mg, partial
TrEMBLV4M1Y00.0V4M1Y0_EUTSA; Uncharacterized protein (Fragment)
STRINGBra020652.1-P1e-136(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132221624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49240.11e-88pseudo-response regulator 4